PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_06702.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 379aa    MW: 41562.8 Da    PI: 7.3443
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_06702.1_g00005.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.5e-32198253156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Sme2.5_06702.1_g00005.1 198 KQRRCWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 253
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.542195255IPR017930Myb domain
SuperFamilySSF466891.4E-18196256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-29196256IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-27198253IPR006447Myb domain, plants
PfamPF002491.5E-7200251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MERCQQYIDA LEEERKKIQV FSRELPLCLE LVIQAIETYK QQLSGTTTEY NLNAQSTECS  60
EDEHTSSDVP IFEEIIPLKR TFAHEDEEDE SHKSKSFNNG NNNSNPKKSD WLRSVQLWNQ  120
TSDPTPKEEL TSEKVSVVEV KKHGSGGAFH PFKKEKSTVA LAKTPDTSGI VPAATGSSTA  180
GNNSGGENKK EDKDGQRKQR RCWSPELHRR FLHALQQLGG SHAATPKQIR ELMKVDGLTN  240
DEVKSHLQKY RLHTRRPSPS SIHNNNNQQP PQFVVVGGIW VPPPDYAGMA AAAPAASGDA  300
SGVANSNGIY APIATHPKGP LHDHALGGTL KQLRQHNKKS SRSSDERDDS HCHSDGGGVH  360
SNSPATSSST HTTTASPAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074811.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLK4BXE60.0K4BXE6_SOLLC; Uncharacterized protein
STRINGSolyc05g009720.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-75G2-like family protein